Protein Info for A4249_RS13475 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 23 to 42 (20 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 115 to 132 (18 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details amino acids 252 to 274 (23 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details PF00892: EamA" amino acids 21 to 155 (135 residues), 54.6 bits, see alignment E=6.5e-19 amino acids 167 to 291 (125 residues), 40.9 bits, see alignment E=1.1e-14

Best Hits

KEGG orthology group: None (inferred from 47% identity to swi:Swit_3987)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZL9 at UniProt or InterPro

Protein Sequence (316 amino acids)

>A4249_RS13475 DMT family transporter (Brevundimonas sp. GW460-12-10-14-LB2)
MVAAARPSPDPSKAAGEDVVRGILLRIAAAGCFSIMTATLKLASQDGVAAPEMLFYRAFF
GLPVVLAWVLTQPGGLSALSTRRPLAHLGRSALGVAAILCLFQTLTLLPLADATTLSFTA
PIFATILSFFVLKEAVGPRRWAAVAVGFIGVIVVMRPGVGHSVLPLAGVAFALIGAVLTA
GVTITLRQLRDTEHVAAIVFWFFVACSVVGAILLPFVGHWHALGTFGLLIGSGVAGGLAQ
LFMTASLQKAPVAVVAPFDYLQIVGAIVFGWWLMAATPTLTTLAGAALIASSGLYTAWRE
HIRRKASLIQPTAPLV