Protein Info for A4249_RS13365 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: DUF885 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 602 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF05960: DUF885" amino acids 53 to 598 (546 residues), 527.2 bits, see alignment E=4.8e-162

Best Hits

KEGG orthology group: None (inferred from 52% identity to pzu:PHZ_c0941)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I2B8 at UniProt or InterPro

Protein Sequence (602 amino acids)

>A4249_RS13365 DUF885 family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MIDRRRLLLTAAATAAVAPAAAQAQTQTTAADADGRLNSLLDGWFEADIDENPEGATNLG
LDHGTRAGLSAKLSEAGPAAIRNDRQKAVSRWAQLDAFDQSGLSPAGALNYAIAAFGAET
AAQTARFDYGAGPGRPSPYIVTQLSGAYFSTPDFLDNQHRIEDAAGADAFLSRLEAFSGV
LEGETAKIQEDAGLGVIPPDFIIDRMLPQIRTLHDTPAADLAMLKSLARKTAGLGLTGYD
ARAAAIVDQKVKPALAAQIEALEALRPRATHEAGVWRLPDGEAFYAAGLKANTTTTLTAK
EIHALGREQVAEISAEIDAILKAQGYTQGTVGERIQALNKDPAQLFANTDAGKAELLAWL
NMLVSDLEPKLPQVFGRLPKSHVEIRRVPVSIQSGAPGGYYQGPPLDGSRPGAYYINLRD
TGNWPRFALPTLTYHEASPGHHLQVALQRESDELPQWRRAGGFSAYNEGWALYAEAVAAD
DLGVYADNPLGRVGFLMSYLFRAVRLVVDTGLHSERWSREQAVDYMATSGAKPLDASNSE
INRYCVWPGQACAYKVGHTVIARLRKEAEGRPGFDLRAFHDKVLENGSLPLAVLERVVRG
QA