Protein Info for A4249_RS13320 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: DNA translocase FtsK 4TM domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 803 signal peptide" amino acids 1 to 52 (52 residues), see Phobius details transmembrane" amino acids 75 to 100 (26 residues), see Phobius details amino acids 115 to 138 (24 residues), see Phobius details amino acids 140 to 140 (1 residues), see Phobius details amino acids 147 to 147 (1 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details PF13491: FtsK_4TM" amino acids 28 to 187 (160 residues), 65.8 bits, see alignment E=8e-22 PF17854: FtsK_alpha" amino acids 308 to 407 (100 residues), 95 bits, see alignment E=5.4e-31 PF01580: FtsK_SpoIIIE" amino acids 415 to 633 (219 residues), 245.5 bits, see alignment E=8.6e-77 PF09397: FtsK_gamma" amino acids 738 to 797 (60 residues), 91.9 bits, see alignment 3.4e-30

Best Hits

Predicted SEED Role

"Cell division protein FtsK" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton or Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I1Z3 at UniProt or InterPro

Protein Sequence (803 amino acids)

>A4249_RS13320 DNA translocase FtsK 4TM domain-containing protein (Brevundimonas sp. GW460-12-10-14-LB2)
MSTALVIGRQAWISARILWDAPFVVRFRGVLQALLATLLLVALVSWNPADASLNAASSLP
TTNWLGTNGALFADLFMQSLGLAAWPAALLLVAFGLARAVGDAIQQRLKPTPLKALAATG
GVLLLSSALAALAAPAAWPLAAGLGGLWGDAVTGLAARGLGALHIPGGRIIAGLVFLIFG
LWLVGFAIGLRAMDFLDALHWGKSLRAPAPPQPKPQAAREKAPAKARAPRAAPPEEAPLA
PTYAEEPPQTAYDDLPPWEDDAVQPAPRPSAARPVEPRVAAVKAPKARKDDVDQQAFDFV
RPEGDFDLPPLGILTKPAQRVGSVDEDSLKQNAKMLEGVLQEFGVRGVIDQIRPGPVVTL
YELVPAPGVKHGRVVALADDIARSMSARACRISVVQGRNAIGIELPNAKRETVYLRDLLA
SAEYDKKGHLLPLALGETIGGEPYVADLARMPHLLIAGTTGSGKSVGVNAMILSILYRHS
PAECRFIMIDPKMLELSVYDGIPHLLAPVVTDPKKAVVALKWTVREMEDRYRRMSKLGVR
NIASYNERAREAQAKGEHFERTVQTGFDDQGRPVYESEKIRPEPLPFLVVVMDEMADLML
VAGKDVEGAVQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPTRISFQVTSKIDSRT
ILGEQGGEQLLGQGDMLYMAGGGRITRLHGPFVDDKEVEDVCKHLKAQAEPDYLDLITDE
PDGDGDNGFDESGGGGSGDDLYDRAVAVVTRDRKASTSYVQRRLQIGYNRAASLIERMEQ
EGVVSPANHAGKRDVLAGPPPMV