Protein Info for A4249_RS13315 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: UbiH/UbiF/VisC/COQ6 family ubiquinone biosynthesis hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF01494: FAD_binding_3" amino acids 7 to 351 (345 residues), 101.6 bits, see alignment E=8.2e-33 TIGR01988: ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family" amino acids 8 to 403 (396 residues), 426.3 bits, see alignment E=4.9e-132 PF05834: Lycopene_cycl" amino acids 121 to 354 (234 residues), 24.7 bits, see alignment E=1.8e-09

Best Hits

KEGG orthology group: K03185, 2-octaprenyl-6-methoxyphenol hydroxylase [EC: 1.14.13.-] (inferred from 80% identity to bsb:Bresu_0382)

Predicted SEED Role

"2-octaprenyl-6-methoxyphenol hydroxylase (EC 1.14.13.-)" in subsystem Ubiquinone Biosynthesis (EC 1.14.13.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I2R9 at UniProt or InterPro

Protein Sequence (418 amino acids)

>A4249_RS13315 UbiH/UbiF/VisC/COQ6 family ubiquinone biosynthesis hydroxylase (Brevundimonas sp. GW460-12-10-14-LB2)
MADTERYDIVIAGAGLTGAAFALAAAQAQLKVVMVDPQPFSDQLAPTFDGRSTAVAFSTF
RMLDALGLGETLRPHACRMDHILVTDGRRPGAASRSASPAFLRFDADEIGGRTGGEPLGY
MVENRRIRAALAEAVTRAGIAVRAPASVASVATDAGKATVTLADGSTLIAPLVVGAEGRG
STVRRAAGIETVGWGYGQSGVVATVRLGRDHGNVAHEYFLPSGPFAILPLTDQRASLVWT
ETTRRGEALRDASDDAFHAHLMRRFGEFLDGATVEGPRFVYPLSLSLAEKLIAPRIALIG
DAAHGVHPVAGQGLNMGLKDAAALAEVLAEAARLGEDIGSETVLERYARWRRFDNAALAA
GFDAFVRLFSNDIAPVRLARDLGMAAVNRIGPLRRAFMQEAGGATGDLPRLLRGEAVV