Protein Info for A4249_RS13305 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: YraN family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 transmembrane" amino acids 31 to 45 (15 residues), see Phobius details PF02021: UPF0102" amino acids 32 to 120 (89 residues), 44.3 bits, see alignment E=9.6e-16

Best Hits

Swiss-Prot: 55% identical to Y143_CAUVC: UPF0102 protein CC_0143 (CC_0143) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K07460, putative endonuclease (inferred from 65% identity to bsb:Bresu_0431)

Predicted SEED Role

"Endonuclease (EC 3.1.-.-)" (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZD4 at UniProt or InterPro

Protein Sequence (136 amino acids)

>A4249_RS13305 YraN family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MKRLSRPAPVRRPKAAWRQAKGGTAFKSGHAAEWIAAFWLILRGYRVLGFRLKSRAGEID
LLVCRGRVLAVVEVKRRATMEAALLALKPVQYDRLVAAGEAIRRNRPGLKRLDLRIDMVA
LAPWRVPRHLRGVERR