Protein Info for A4249_RS13290 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: diaminopimelate epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00652: diaminopimelate epimerase
  • amino acids 5 to 273 (269 residues), 252.1 bits, E=3.2e-79
• PF01678: DAP_epimerase
  • amino acids 5 to 120 (116 residues), 81.2 bits, E=3.3e-27
  • amino acids 154 to 267 (114 residues), 103.3 bits, E=4.9e-34

Best Hits

Swiss-Prot: 60% identical to DAPF_CAUVN: Diaminopimelate epimerase (dapF) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K01778, diaminopimelate epimerase [EC: 5.1.1.7] (inferred from 81% identity to bsb:Bresu_0458)

Predicted SEED Role

"Diaminopimelate epimerase (EC 5.1.1.7)" in subsystem Lysine Biosynthesis DAP Pathway (EC 5.1.1.7)

MetaCyc Pathways

• aspartate superpathway (21/25 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (14/18 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis II (7/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (11/15 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.7

Sequence Analysis Tools

See A0A168NYV6 at UniProt or InterPro

Protein Sequence (276 amino acids)

>A4249_RS13290 diaminopimelate epimerase (Brevundimonas sp. GW460-12-10-14-LB2)
MTRPFVKMNGAGNDFVVVNALEQPFAPGEDQIRALGDRQTGEGFDQLIAIEPSDTADAFM
RVWNADGSMVETCGNALRCVGWLLMQANGSDRVVIDTAGGPTTATRAGDHRVTVDMGKPR
LDWTQVPLAEEMDTRGIELQVGPMDAPILHTPGAVSMGNPHVVFFTDRQDDGFVTGSGSL
VEHHPLFPQGVNVGFANVLDRDHIRLRVWERGAGLTKACGTGACAALVATARRGLTERKA
TVVVDGGELVIDWDAETDHVLMTGPVEIERTGVLSI