Protein Info for A4249_RS13285 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: potassium channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 205 to 223 (19 residues), see Phobius details PF07885: Ion_trans_2" amino acids 156 to 226 (71 residues), 50.6 bits, see alignment E=7.3e-18

Best Hits

KEGG orthology group: None (inferred from 70% identity to bsb:Bresu_0456)

Predicted SEED Role

"Potassium voltage-gated channel subfamily KQT; possible potassium channel, VIC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I1H1 at UniProt or InterPro

Protein Sequence (264 amino acids)

>A4249_RS13285 potassium channel family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MSQTETDPKDNSLRLRARLRYLYHGSQPAAVKFRLTVIVIDLAIIGFFLAAPILKNMGWA
FYALDYFIAAILALDLAARAYAYANIKDWLKRPIVWVDLFVLATLLFPAWLFNLGFLRML
RLWTLLNSDFFWRTVGARFDDTRVEGIARALANLITFVFVATGFVYATFRGHDGIAGYVD
ALYFTVATLTTTGFGDVTLPGPWGRLLSIAVMLVGITLFLRLAQALIRPHKVHFPCDRCG
LQNHDPDAVHCKACGNLLCIPDEG