Protein Info for A4249_RS13260 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: glycerol kinase GlpK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 TIGR01311: glycerol kinase" amino acids 3 to 501 (499 residues), 625.1 bits, see alignment E=3.4e-192 PF00370: FGGY_N" amino acids 4 to 262 (259 residues), 212.6 bits, see alignment E=7e-67 PF02782: FGGY_C" amino acids 272 to 459 (188 residues), 141.8 bits, see alignment E=2.5e-45

Best Hits

Swiss-Prot: 52% identical to GLPK_RHORT: Glycerol kinase (glpK) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00864, glycerol kinase [EC: 2.7.1.30] (inferred from 81% identity to bsb:Bresu_0337)

MetaCyc: 51% identical to glycerol kinase (Escherichia coli K-12 substr. MG1655)
Glycerol kinase. [EC: 2.7.1.30]

Predicted SEED Role

"Glycerol kinase (EC 2.7.1.30)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or MLST (EC 2.7.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I1Y8 at UniProt or InterPro

Protein Sequence (509 amino acids)

>A4249_RS13260 glycerol kinase GlpK (Brevundimonas sp. GW460-12-10-14-LB2)
MSLILAIDQGTTSTRAIAFEVAPQAARSAVGEEKGDLRPVAVSQIELAQHFPKSGWVEHD
AGEIWTATLQTCREVVRKAGGVARFNAIGITNQRETAVIWDAATGEPLHRAIVWQDRRTA
DVTARLTAQGNEPIVQTATGLILDPYFSATKFAWLLDAVPGSRERATKGEVKLGTIDAWL
IWKLTGGRVHATDATNASRTSLMDLRTVKWRDDLCDVFDVPREALPDIVSCAGVIGESDP
ALFGQPLPIAGSAGDQQAALVGHGALKAGDAKITYGTGAFLVANVGAEPVASTRRLLGTL
GYQADGQSAYALEGSIFSAGSAIQWLRDGVGLISESRQSEAMAQTLKDNGGVYMVPGFTG
LGAPWWEPEARGTIVGLTRDSGPAHFVRAALEALAYQTRDLLDALAADGAPPLKTLKVDG
GVTANSFAMQFVSDICEVEVERPAFQEMTALGAARLAALGVGLLPDLEARPAEAPACWKP
RMKADERERLLSGWRRAVKAAIIAASDRA