Protein Info for A4249_RS13240 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: OmpA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 36 to 54 (19 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details PF13441: Gly-zipper_YMGG" amino acids 34 to 83 (50 residues), 37.5 bits, see alignment E=2.3e-13 PF13488: Gly-zipper_Omp" amino acids 38 to 88 (51 residues), 36.6 bits, see alignment E=5e-13 PF00691: OmpA" amino acids 118 to 213 (96 residues), 72.3 bits, see alignment E=5.3e-24

Best Hits

Swiss-Prot: 44% identical to YIAD_ECOLI: Probable lipoprotein YiaD (yiaD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 78% identity to bsb:Bresu_0767)

Predicted SEED Role

"Outer membrane lipoprotein omp16 precursor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZI0 at UniProt or InterPro

Protein Sequence (224 amino acids)

>A4249_RS13240 OmpA family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MRAKFIVASVSIAALLGAAACTTTDPYRSGPVRNNTGTGAIAGALGGAVLGYLTNTSNGE
QGRKNALIGAGIGALGGAAVGQYMDRQQRAMEAELSGSGVGVARQGDLLVLRMPSDVTFA
TNQSSIDPRFLPVLDDVARVLQQYDQSTVDVIGHTDSSGGDAINQPLSERRASSVASELV
RRGVIAQRLYVAGNSSRNPVASNATAEGKAQNRRVEILIRPFTG