Protein Info for A4249_RS13210 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: pirin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF02678: Pirin" amino acids 16 to 122 (107 residues), 121 bits, see alignment E=2.3e-39 PF05726: Pirin_C" amino acids 175 to 277 (103 residues), 84.8 bits, see alignment E=5.1e-28

Best Hits

KEGG orthology group: K06911, (no description) (inferred from 83% identity to bsb:Bresu_0010)

Predicted SEED Role

"Pirin-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I1G1 at UniProt or InterPro

Protein Sequence (312 amino acids)

>A4249_RS13210 pirin family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MIELVIDARRKDLGGFEVGRVLPFHSRRMVGPFIFLDQMGPAEFAPGATAIDVRPHPHIG
LSTLTYLFEGEIMHHDNLGYDQAIRPGEVNWMTAGKGIVHSERTDPLKKSKGGPMHGMQA
WVALPDEAEEMDPAFHHLGEDAQPAYENGGLFARLVAGEAYGAKAAVPVSSPLFYIHWEL
QPGVRTAPPSGKGAGGMSERALYVAKGSIEVGDRTFHEGQMIVLEPTAEPTVKAVTQSTV
MVLGGEPVGERLIWWNFVASSQARIDQAKADWKAGRMTLPDADDLEFIPLPDEQGKAQAE
PAPVTPKPTDPV