Protein Info for A4249_RS13185 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: dihydrolipoyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 PF07992: Pyr_redox_2" amino acids 8 to 326 (319 residues), 226 bits, see alignment E=1.7e-70 PF01134: GIDA" amino acids 8 to 150 (143 residues), 27 bits, see alignment E=6e-10 TIGR01350: dihydrolipoyl dehydrogenase" amino acids 8 to 465 (458 residues), 444.8 bits, see alignment E=1.7e-137 PF00070: Pyr_redox" amino acids 179 to 245 (67 residues), 63.5 bits, see alignment E=5.2e-21 PF02852: Pyr_redox_dim" amino acids 345 to 454 (110 residues), 84.6 bits, see alignment E=1.4e-27

Best Hits

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 91% identity to bsb:Bresu_3327)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of branched-chain alpha-keto acid dehydrogenase (EC 1.8.1.4)" in subsystem Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 1.8.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZB7 at UniProt or InterPro

Protein Sequence (465 amino acids)

>A4249_RS13185 dihydrolipoyl dehydrogenase (Brevundimonas sp. GW460-12-10-14-LB2)
MTQTLKTKVLIIGAGTGGYVAGIRCGQLGLDTVLVDGGDGLGGTCLNVGCIPSKAIIHAA
GKFETVAKAAGGGTLGITAAAPAIDLSQTVAWKDGIVRKLNAGVAALLKKAKVKVIKGWA
EFADAKTCVVKTDEGDIRITAEHVILATGSEPVELPFLPFGGDVISSTEALSLSEVPKKL
VVVGGGYIGLELGIAYRKLGAEVAIVEMAERILPLYDKALTDPVAKWLEKHGVELHLGAR
AGGFGDGKLSITTKDGEPLQLDADKVLVTVGRRPRTQGWGLENMGVAMAGPFVKIDQRCA
ASMKNVWAVGDLTGEPMLAHKGSAQGEVVAEIIAGHDRIFDPVTIAAVCFTEPEIVSAGL
GPNEVAGRDDVIQSVFPFAAIGRALAIEAGEDGGFVRVIASKADHRILGIQAVGQHVSEL
SNSFAQMMEMGAVLEDVAGTIHVHPTLGEAFHEASLRALGHAIHI