Protein Info for A4249_RS13145 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: dienelactone hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details PF01738: DLH" amino acids 68 to 296 (229 residues), 185.4 bits, see alignment E=1.7e-58 PF00326: Peptidase_S9" amino acids 142 to 276 (135 residues), 28.3 bits, see alignment E=1.8e-10

Best Hits

KEGG orthology group: K01061, carboxymethylenebutenolidase [EC: 3.1.1.45] (inferred from 70% identity to bsb:Bresu_0208)

Predicted SEED Role

"Dienelactone hydrolase family"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I1X3 at UniProt or InterPro

Protein Sequence (299 amino acids)

>A4249_RS13145 dienelactone hydrolase family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MTVLIRPEGQTADDLKLSRRTLGALGGLLFSGYAIAALAKEAKPITTDEAGLATETVTYA
APDGFQLPAYVARPAGEGPFPVVVVVSEIFGVHEYIRDICRRLAKQGYAAIAPAFFVRVE
DPAPLSDMQRIMQIVGAAHYEQVMGDLSATLEWASQQSWSKDGKVGITGYCWGGKVVWQA
AARFAAIGAGVAWYGRLAPAADATPVQISSGQPWPVDIADDLKAPVLGLYGGKDQGIPLA
SVERMREALARAGQTGSQIVVYPDAQHGFHADYRASYSEADAKDGWSKLLATFDKALKN