Protein Info for A4249_RS13130 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: heat-inducible transcriptional repressor HrcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 TIGR00331: heat-inducible transcription repressor HrcA" amino acids 23 to 358 (336 residues), 292.8 bits, see alignment E=2.3e-91 PF01628: HrcA" amino acids 123 to 345 (223 residues), 192.9 bits, see alignment E=3.7e-61

Best Hits

Swiss-Prot: 78% identical to HRCA_CAUSK: Heat-inducible transcription repressor HrcA (hrcA) from Caulobacter sp. (strain K31)

KEGG orthology group: K03705, heat-inducible transcriptional repressor (inferred from 82% identity to bsb:Bresu_0210)

Predicted SEED Role

"Heat-inducible transcription repressor HrcA" in subsystem Heat shock dnaK gene cluster extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I2S1 at UniProt or InterPro

Protein Sequence (364 amino acids)

>A4249_RS13130 heat-inducible transcriptional repressor HrcA (Brevundimonas sp. GW460-12-10-14-LB2)
MYAPKNPPFDAGQSLAGLAGLDARARDIFRRIVESYLETGEPVGSRTLSLGGIALSPASI
RNTMQDLTLAGLLAAPHTSAGRIPTHAGLRLFVDGLLEVGDLTKEERREIDGRLAGRGRN
FEAALDEASNLLSGLAGGAGVVSSPVRDSGVKHVEFVALGGDQALAVIVADDGTVENRIM
TLSAGVTPSTLVEASNFLNARLRGRPFADAKREMTQELEIARRELDQTAARLVEDGFAAW
SGGQDRERALIVRGRANLLQDREGLADLERVRVLFDDLEQKEQLIGLLDGVDAAQGVRIF
IGAETRLFSLSGSAVIAAPYMSGRQRVLGAIGVIGPARLNYARVIPLVDYTARVLGRMLD
GNDK