Protein Info for A4249_RS12925 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13174: TPR_6" amino acids 73 to 101 (29 residues), 14.9 bits, see alignment (E = 1.9e-05) PF13181: TPR_8" amino acids 74 to 102 (29 residues), 14.5 bits, see alignment (E = 1.9e-05) amino acids 140 to 170 (31 residues), 12.1 bits, see alignment 0.00011 PF13432: TPR_16" amino acids 74 to 118 (45 residues), 27.4 bits, see alignment 2.2e-09 amino acids 126 to 171 (46 residues), 18.5 bits, see alignment 1.4e-06 amino acids 176 to 232 (57 residues), 18.1 bits, see alignment E=1.8e-06 PF14559: TPR_19" amino acids 80 to 118 (39 residues), 26.8 bits, see alignment 2.9e-09 amino acids 152 to 200 (49 residues), 26.6 bits, see alignment 3.5e-09 PF07719: TPR_2" amino acids 140 to 170 (31 residues), 24 bits, see alignment 1.5e-08

Best Hits

KEGG orthology group: None (inferred from 63% identity to bsb:Bresu_0601)

Predicted SEED Role

"Flp pilus assembly protein TadD, contains TPR repeat" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I1B5 at UniProt or InterPro

Protein Sequence (278 amino acids)

>A4249_RS12925 tetratricopeptide repeat protein (Brevundimonas sp. GW460-12-10-14-LB2)
MSRMPALLATVALIALSGTPALAADPTAATAAQARAPSSAAVRATYDRMDALSRSVFWAS
EQQADPTDAVAGVKLAQALRELGRYDQAAEAAQATLTIQPNNLDALLELGRAHIARGQAF
YGVAPLEQARDLAPRDWRPYSLLGVAYEQVRRTDDARAAWNQALALSPDNPDVLTNAATA
ALTHGDAPGAETLLRRAVAQPTASAKVRQNLAMVLGLQGKMGEAEQILRRELPPEQAEQN
LQWLRSRSTGGAATSGGGAASPSPATDTARTWNSLQGG