Protein Info for A4249_RS12860 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: DUF350 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details PF03994: DUF350" amino acids 29 to 80 (52 residues), 37.6 bits, see alignment E=9e-14 amino acids 92 to 144 (53 residues), 48.1 bits, see alignment E=4.8e-17

Best Hits

KEGG orthology group: K08989, putative membrane protein (inferred from 76% identity to bsb:Bresu_0198)

Predicted SEED Role

"FIG00482946: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161IX09 at UniProt or InterPro

Protein Sequence (146 amino acids)

>A4249_RS12860 DUF350 domain-containing protein (Brevundimonas sp. GW460-12-10-14-LB2)
MDPSLSNVLSSAEVQAFASGFPVMVMHLIVTLLLLAAGATVYALLTPWKEVALIRQGNVA
AAIAFAGILVGLAVPLAVSLSVSTSVRDIAIWGVATVVLQLLAFRVVDLLLTGLPERIRH
GEISAAVVLLGAKLATAVILSAALTG