Protein Info for A4249_RS12845 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 573 transmembrane" amino acids 12 to 41 (30 residues), see Phobius details amino acids 61 to 84 (24 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details PF00512: HisKA" amino acids 209 to 274 (66 residues), 73 bits, see alignment E=2.4e-24 PF02518: HATPase_c" amino acids 320 to 429 (110 residues), 103.6 bits, see alignment E=1.3e-33 PF00072: Response_reg" amino acids 451 to 565 (115 residues), 95.5 bits, see alignment E=3.5e-31

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I1U7 at UniProt or InterPro

Protein Sequence (573 amino acids)

>A4249_RS12845 ATP-binding protein (Brevundimonas sp. GW460-12-10-14-LB2)
MVTPPAVLYGSWAAAGLILAALGQPWVGLGFALVGMAFDAWAQGRVRRYQKAEAPVAGWP
PLLIAIVAIRFALGVSGPLVAWLMNPRADVMLVVVLIQVWSIGVAFVQFSAAPRLLALAA
APICATVLVVIYPSLIGPHGLAVAAAFVMLATILFIISRATHALWCDLFAADQRNKALLM
DVQAAHEAAVRDRDAARCARQEADEANAAKSRFLANMSHEIRTPLNGVIGMAQIMAGDAL
EDRQKTRLEILDRSAHTLLDLINQILDLSRIEEGRLEIVPQPIDADALVHEVTETLRPLA
ESKGLAFHVVSPGLGWVSADAVRLRQILFNLLSNAIKFTAEGQVALEVALTDAGAVFRVS
DTGRGIPADQIGQLFTRFAQIEAAAVDRRDGAGLGLSIVATLVDLMGGRIKVESEAGEGA
TFVVTLPLTPAQPVQAGEDAPDAQPERALRVLVAEDHPVNQQVIRGLLGQVGIEVEIVDD
GVQAVEATQTRDWDLILMDVQMPNMDGPTATRTIRQREADQGLVRTPIIALTANAMVEQV
ESYLAAGMDAVVSKPVDLKVLLTAISDVMSAKT