Protein Info for A4249_RS12815 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: DUF3429 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details PF11911: DUF3429" amino acids 12 to 150 (139 residues), 69.1 bits, see alignment E=2.5e-23

Best Hits

KEGG orthology group: None (inferred from 45% identity to eli:ELI_05145)

Predicted SEED Role

"FIG00636177: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I1C0 at UniProt or InterPro

Protein Sequence (154 amino acids)

>A4249_RS12815 DUF3429 domain-containing protein (Brevundimonas sp. GW460-12-10-14-LB2)
MTIEPTGRHRLPPLARILGFAGLLPQAAAVVVLLVGDADQQTAALGLAYAYAALIFSFLG
GVWWGLAAATGVKAPKWVWTASVAPSLLALATSVVWAAGLDPAVSLVVLGVFIAASVLVD
LKLKAAGLTPEGWLALRAPLSIGLGVLTLVAGLI