Protein Info for A4249_RS12695 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: EamA family transporter RarD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 109 to 126 (18 residues), see Phobius details amino acids 133 to 151 (19 residues), see Phobius details amino acids 156 to 172 (17 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details amino acids 270 to 291 (22 residues), see Phobius details PF00892: EamA" amino acids 15 to 147 (133 residues), 29.4 bits, see alignment E=3.9e-11 TIGR00688: protein RarD" amino acids 20 to 262 (243 residues), 178.7 bits, see alignment E=7.7e-57

Best Hits

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 66% identity to bsb:Bresu_0446)

Predicted SEED Role

"RarD protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I2N0 at UniProt or InterPro

Protein Sequence (308 amino acids)

>A4249_RS12695 EamA family transporter RarD (Brevundimonas sp. GW460-12-10-14-LB2)
MTASPSPNDPRAVGTAIACYTLWGLLPLLFMAMAAHGFGAPEILAHRAVWSVFVAGLVLL
LAGQWGEARRVLATPRTLAWLALSALLIGTNWSLYVFATTHHATLEASLGYYINPLLNMA
AGAVLFREKIDRWSALAIGLAAVGVVIQTIALGHVPIIGLTLAVTFCAYAVIRKRVPASA
QTGLFVECLVLLPIGAVFLAWLTTHGQAVGFASPSGLIWALVNGPATVIPLALFAWSARR
LPLSTVGFIQFLAPTLQFACGVATGEPLTLLRIVSFVFIWAGAGVFALAAFNRSRAAREA
LKTTAEPA