Protein Info for A4249_RS12675 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: malate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01763: malate dehydrogenase, NAD-dependent
  • amino acids 3 to 309 (307 residues), 402.5 bits, E=5.8e-125
• PF00056: Ldh_1_N
  • amino acids 5 to 143 (139 residues), 136 bits, E=9.9e-44
• PF02866: Ldh_1_C
  • amino acids 148 to 304 (157 residues), 115.2 bits, E=3.5e-37

Best Hits

Swiss-Prot: 89% identical to MDH_CAUVC: Malate dehydrogenase (mdh) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00024, malate dehydrogenase [EC: 1.1.1.37] (inferred from 95% identity to bsb:Bresu_0442)

MetaCyc: 73% identical to malate dehydrogenase subunit (Methylorubrum extorquens AM1)
Malate dehydrogenase. [EC: 1.1.1.37, 1.1.1.38]

Predicted SEED Role

"Malate dehydrogenase (EC 1.1.1.37)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 1.1.1.37)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (7/7 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle III (animals) (9/10 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• glyoxylate cycle (6/6 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• gluconeogenesis III (10/12 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• gluconeogenesis I (10/13 steps found)
• malate/L-aspartate shuttle pathway (2/2 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
• chitin deacetylation (2/4 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (7/11 steps found)
• pyruvate fermentation to propanoate I (4/7 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• mixed acid fermentation (10/16 steps found)
• methylaspartate cycle (12/19 steps found)
• reductive TCA cycle I (6/11 steps found)
• incomplete reductive TCA cycle (3/7 steps found)
• methylgallate degradation (2/6 steps found)
• formaldehyde assimilation I (serine pathway) (7/13 steps found)
• reductive TCA cycle II (6/12 steps found)
• protocatechuate degradation I (meta-cleavage pathway) (3/8 steps found)
• L-glutamate degradation VIII (to propanoate) (4/11 steps found)
• superpathway of vanillin and vanillate degradation (3/10 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (5/13 steps found)
• syringate degradation (3/12 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (19/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Citrate cycle (TCA cycle)
• Glyoxylate and dicarboxylate metabolism
• Pyruvate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.37

Use Curated BLAST to search for 1.1.1.37 or 1.1.1.38

Sequence Analysis Tools

See A0A160I1S8 at UniProt or InterPro

Protein Sequence (320 amino acids)

>A4249_RS12675 malate dehydrogenase (Brevundimonas sp. GW460-12-10-14-LB2)
MARAKIALIGAGMIGGTLAHVAAREALGDVILFDIAEGTPQGKALDIAEASAVFGQDVAL
KGANDYADIAGADVCIVTAGVPRKPGMSRDDLIGINLKVMKAVGEGIKAHAPNAFVICIT
NPLDAMVWALQKFSGLPKEKVVGMAGVLDSARFAYFLAEKTGVSVQDIHAWTLGGHGDDM
VPMVRHSTVGGLPLPDAVAAGFLSQDELDAIVERTRKGGGEIVALLKTGSAFYAPAESAI
AMAKSYLLDQKRVLPCAVWLSGEYGLSDLYVGVPALIGAGGVEKIVEFTTNDEEKAMFEK
SVASVQGLLQACKDIDGSLA