Protein Info for A4249_RS12555 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: argininosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 296 to 313 (18 residues), see Phobius details amino acids 327 to 346 (20 residues), see Phobius details TIGR00838: argininosuccinate lyase" amino acids 1 to 454 (454 residues), 571 bits, see alignment E=1e-175 PF00206: Lyase_1" amino acids 4 to 298 (295 residues), 253.3 bits, see alignment E=3.9e-79 PF14698: ASL_C2" amino acids 361 to 429 (69 residues), 90.8 bits, see alignment E=6.4e-30

Best Hits

Swiss-Prot: 76% identical to ARLY_CAUVC: Argininosuccinate lyase (argH) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K01755, argininosuccinate lyase [EC: 4.3.2.1] (inferred from 86% identity to bsb:Bresu_0616)

MetaCyc: 43% identical to argininosuccinate lyase (Escherichia coli K-12 substr. MG1655)
Argininosuccinate lyase. [EC: 4.3.2.1]

Predicted SEED Role

"Argininosuccinate lyase (EC 4.3.2.1)" in subsystem Arginine Biosynthesis extended (EC 4.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZ27 at UniProt or InterPro

Protein Sequence (454 amino acids)

>A4249_RS12555 argininosuccinate lyase (Brevundimonas sp. GW460-12-10-14-LB2)
MWGGRFSSRPAEIMQAINVSIGVDQRLWRQDLAGSRAHCRMLAKQGIIAQADADAILGGL
EVIQSEIEAGTFPFRDQFEDIHMNVEARLNELIGEPSGRLHTARSRNDQVAVDFRLWVRD
ACDRSVAQLKALQAALLTRAEQHAGDLMPGFTHLQTAQPVTLGHHLMAYVEMFGRDAGRF
ADARARMNESPLGAAALAGSPFPIDRQMTAAELGFDRPMANSLDAVSDRDFALESLAAAS
ITAGHLSRLAEEIVVWMTPMFGFASLPDDLTTGSSIMPQKRNPDAAELVRAKTGRIMGSL
VALSTVMKGLPLAYSKDMQEDKPPVFEAFDALDLALVAMTAMVSALQPNTERMAQAAGAG
FSTATDLADWLVRELNLPFRKAHHVTGAAVKRAEGLGVDLSQLPLEEMQKLEPGITEAVY
KVLTAEASCQSRQSYGGTAPEQVRARIADWRARL