Protein Info for A4249_RS12495 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: Hsp20 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 PF00011: HSP20" amino acids 44 to 141 (98 residues), 63.2 bits, see alignment E=1.1e-21

Best Hits

Swiss-Prot: 59% identical to IBPA_SALCH: Small heat shock protein IbpA (ibpA) from Salmonella choleraesuis (strain SC-B67)

KEGG orthology group: K04080, molecular chaperone IbpA (inferred from 84% identity to bsb:Bresu_0569)

Predicted SEED Role

"16 kDa heat shock protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I2A8 at UniProt or InterPro

Protein Sequence (159 amino acids)

>A4249_RS12495 Hsp20 family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MRTYDFTPLYRSAVGFDRLANLLENASRATSQDTGYPPYNIETTGENAYRIEIAVAGFSP
DELNIEVKENLLTVTGRKTANDDTATQKTYLHRGLAERDFERRFQLADYVVVNDANLVNG
LLSISLKRELPEALKPRRIEIGAGQPLIEGQAEKKAEAA