Protein Info for A4249_RS12450 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 117 to 133 (17 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 524 to 548 (25 residues), see Phobius details PF09924: LPG_synthase_C" amino acids 232 to 520 (289 residues), 300.3 bits, see alignment E=1.4e-93 PF13480: Acetyltransf_6" amino acids 340 to 469 (130 residues), 27.7 bits, see alignment E=2.7e-10

Best Hits

KEGG orthology group: K07027, (no description) (inferred from 42% identity to cak:Caul_1448)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I1Q2 at UniProt or InterPro

Protein Sequence (551 amino acids)

>A4249_RS12450 GNAT family N-acetyltransferase (Brevundimonas sp. GW460-12-10-14-LB2)
MSSRPRHTSGLIRRLAGLAFELTPQIFAVLAFGAGALMLASAVTPEFDSRLRQLTGVVSP
ILIDLSHFVGSIAGFLLLLLSAGLWRRRRGAYWAALLVLAVGAVFSVLKGLDWEQATDLL
VVAALLAPCRTAFNRRSRLSEPLRPSWLLLLTAVVAAMLWLGFFAYRDVAYNDELWWRFL
SDRQASGFLRAGLVLAILTLVVAGRSLLSSPGAHSHGPASKADIDRALQALQTADTATPE
AWLAMLGDKALMFSPSGSSFLAYRVRGRRWIAMGEPAGLKSERLELLWSFAEMADSYGGA
AVFYSVSEEVLGDLATMGLAVRKVGETAVIDAHRFSIEGKGKQNLRTAINRAEREGSSFE
VLPPGSAAAIADELREISDAWLAMHEGSEKSFSLGRFDVDYLDLTPLAVVKEGGRVVAFA
NLLTSPDEAAVDLMRHRPDAPHGVMDYLFIRCAQWAKAEGLASFDLGMAPLAGLEDRRIA
PVFARVGALVFEEGGALYGFQGLRSYKAKFGPDWRSRFIAAPVSTPLPLALLDVALLTSG
GWLGMLGLKKA