Protein Info for A4249_RS12415 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: cation:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 611 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 33 to 49 (17 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details amino acids 161 to 186 (26 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 239 to 257 (19 residues), see Phobius details amino acids 263 to 281 (19 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details amino acids 320 to 342 (23 residues), see Phobius details amino acids 353 to 372 (20 residues), see Phobius details amino acids 384 to 401 (18 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 13 to 393 (381 residues), 176.3 bits, see alignment E=9e-56 PF02254: TrkA_N" amino acids 428 to 541 (114 residues), 76.1 bits, see alignment E=2.9e-25

Best Hits

KEGG orthology group: K03455, monovalent cation:H+ antiporter-2, CPA2 family (inferred from 74% identity to bsb:Bresu_0565)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system protein KefB" in subsystem Glutathione-regulated potassium-efflux system and associated functions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161IIX2 at UniProt or InterPro

Protein Sequence (611 amino acids)

>A4249_RS12415 cation:proton antiporter (Brevundimonas sp. GW460-12-10-14-LB2)
MHGQGGDYKDLVVFLAAAGVIVPLVNRLKVSPVLGFLAAGVLLGPDGLGRFAQSLPWLSW
LTIGDPRQLAQLSELGVAFLLFMIGLELSWERLRAMRRLVFGLGLMQVVVCTAVLAGGFM
LMGQTLASAVVLGMGLALSSTAVVMPVLAERGRLKGTVGRSTFAILLAQDLSVAPILITV
TVLAALAQQGGALDPAILGRALFTLVPAAIGLGLMVLLGRVVLRPMFRSVAKARKADQGG
ELFVAASLLVVVGAGLAAQASGLSMSIGALLAGVLLAETEFRREVEVSIEPFKGLLLGVF
FVGVGLGLDLDAIAADPVGVFGLALALTVLKTGVIFSLARFWGLGARPALETALVLAPAG
EFAFVVFATGLVEGLAPPQLTNTVALSATVSIFSIPLLALLGQKLARKSSAAGQPVELPK
LEAADGAVIIVGFGRVGRLIGEMLKAHDQPFIALDTDAGAVAKGRRDGFDVFYGDAGRRE
MLQHCGVQSTRALIVTMDAPTKVDEVVTTARSMRDDLILIARARDDQHAIRLYGLGVTDA
VPETTEASLQLAENTLVDLGVPMGLVLASVHERRDQFRKAFQSAIPIERRNRPSRALRRT
LRPARVDPAPE