Protein Info for A4249_RS12390 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ATP-dependent protease subunit HslV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 PF00227: Proteasome" amino acids 12 to 183 (172 residues), 103.5 bits, see alignment E=5.6e-34 TIGR03692: ATP-dependent protease HslVU, peptidase subunit" amino acids 14 to 184 (171 residues), 276.6 bits, see alignment E=3.5e-87

Best Hits

Swiss-Prot: 84% identical to HSLV_CAUSK: ATP-dependent protease subunit HslV (hslV) from Caulobacter sp. (strain K31)

KEGG orthology group: K01419, ATP-dependent HslUV protease, peptidase subunit HslV [EC: 3.4.25.2] (inferred from 91% identity to bsb:Bresu_0019)

MetaCyc: 57% identical to peptidase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent protease HslV (EC 3.4.25.-)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent (EC 3.4.25.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.25.- or 3.4.25.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZ03 at UniProt or InterPro

Protein Sequence (186 amino acids)

>A4249_RS12390 ATP-dependent protease subunit HslV (Brevundimonas sp. GW460-12-10-14-LB2)
MTQTASNFPDWHGTTILAVRKNGRTVIAGDGQVSMGPTIVKGAARKVRTLAGGKVLAGFA
GATADAFTLIERLEAKLEQYPDQLARACVDLAKDWRTDRYLRRLEAMLLVADKSSIFTVT
GVGDVLEPEYGVAAVGSGGNYALSAARALIEETDLDAEQVARKAMKIAAEICVYTNGNLT
VETLQA