Protein Info for A4249_RS12320 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: acyl-CoA thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03061: 4HBT
  • amino acids 28 to 100 (73 residues), 54.7 bits, E=5.3e-19

Best Hits

Swiss-Prot: 49% identical to YCIA_ECOL6: Acyl-CoA thioester hydrolase YciA (yciA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K10806, acyl-CoA thioesterase YciA [EC: 3.1.2.-] (inferred from 77% identity to bsb:Bresu_3182)

MetaCyc: 49% identical to acyl-CoA thioesterase YciA (Escherichia coli K-12 substr. MG1655)
Acyl-CoA hydrolase. [EC: 3.1.2.20]

Predicted SEED Role

"cytosolic long-chain acyl-CoA thioester hydrolase family protein" in subsystem Serine-glyoxylate cycle

MetaCyc Pathways

• firefly bioluminescence (2/14 steps found)
• jasmonic acid biosynthesis (4/19 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.- or 3.1.2.20

Sequence Analysis Tools

See A0A160HZ54 at UniProt or InterPro

Protein Sequence (133 amino acids)

>A4249_RS12320 acyl-CoA thioesterase (Brevundimonas sp. GW460-12-10-14-LB2)
MSDAPEYPPEDQPVGRIIAMPADTNPEGDIFGGWLLAQMDLAGATPAFELACGRCATVAL
DGMVFHQPVSVGDEVSIYAHVIGSGRTSIRVQVEAWKRARGQPQAASVRVTQGVFTYVAI
DEHRKPRALPGKA