Protein Info for A4249_RS12295 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: trehalose-phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR00685: trehalose-phosphatase" amino acids 23 to 250 (228 residues), 165.9 bits, see alignment E=1.6e-52 TIGR01484: HAD hydrolase, family IIB" amino acids 24 to 214 (191 residues), 48.3 bits, see alignment E=1.3e-16 PF02358: Trehalose_PPase" amino acids 25 to 239 (215 residues), 116.2 bits, see alignment E=6.6e-38

Best Hits

KEGG orthology group: K01087, trehalose-phosphatase [EC: 3.1.3.12] (inferred from 62% identity to bsb:Bresu_0756)

Predicted SEED Role

"Trehalose-6-phosphate phosphatase (EC 3.1.3.12)" in subsystem Trehalose Biosynthesis (EC 3.1.3.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I148 at UniProt or InterPro

Protein Sequence (252 amino acids)

>A4249_RS12295 trehalose-phosphatase (Brevundimonas sp. GW460-12-10-14-LB2)
MPSHAGAASLLLPTPPVVADGIALFLDMDGVLAPMAPTPDAVVPTARRTAALKAVEARLA
GRVAIVSGRTLAEIDRISDHALVSGSGVHGLERRLKDGSIERKVADAGVAQALGAFEAFA
ADRPGVIVEDKGVSVGLHYRQAPDEARAAKDIAAELQSETGLTLQPGHMVLELKTPGADK
GTAVTAFMQEAPFKGAVPVMLGDDLTDEYGFEAASALGGYGVLVGPERETAARYRLDDVD
TVLTWLEAVAKA