Protein Info for A4249_RS12185 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: adenosylhomocysteinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 PF05221: AdoHcyase" amino acids 3 to 462 (460 residues), 491.2 bits, see alignment E=2.1e-151 TIGR00936: adenosylhomocysteinase" amino acids 4 to 455 (452 residues), 600.8 bits, see alignment E=6.4e-185 PF00670: AdoHcyase_NAD" amino acids 224 to 383 (160 residues), 275.2 bits, see alignment E=4.2e-86 PF02826: 2-Hacid_dh_C" amino acids 243 to 333 (91 residues), 31.2 bits, see alignment E=2.9e-11 PF07991: IlvN" amino acids 244 to 309 (66 residues), 22.9 bits, see alignment E=1.1e-08

Best Hits

Swiss-Prot: 88% identical to SAHH_CAUVC: Adenosylhomocysteinase (ahcY) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K01251, adenosylhomocysteinase [EC: 3.3.1.1] (inferred from 92% identity to bsb:Bresu_0035)

Predicted SEED Role

"Adenosylhomocysteinase (EC 3.3.1.1)" in subsystem Methionine Biosynthesis or Methionine Degradation (EC 3.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I131 at UniProt or InterPro

Protein Sequence (463 amino acids)

>A4249_RS12185 adenosylhomocysteinase (Brevundimonas sp. GW460-12-10-14-LB2)
MTDYIVRDITLADWGNKEIEIAETEMPGLMSLRDEFGASQPLKGARIAGSLHMTIQTAVL
IQTLEALGAEVRWASCNIFSTQDHAAAAIAANGTPVFATKGETLEEYWDYAHKIFEWADG
GYPNLILDDGGDATLLCVLGPKAEKDISVLANPQNEEEEALFKVMKRYLAEKPGFYSAIR
DAIGGVSEETTTGVHRLYQMAEKGELPFPAINVNDSVTKSKFDNLYGCRESLVDAIRRGT
DVMLSGKVAVVCGYGDVGKGSAASLRQGGARVIVTEIDPICALQAAMEGYEVQTLDDTAG
RADIYVTTTGNKDVITVDHMRQMKNNAIVCNIGHFDSEIQVAGLKNFKWDEIKPQVHHVE
FPDGKKIILLSEGRLVNLGNATGHPSFVMSASFTNQTLAQIELWTNADKYENKVYTLPKH
LDEKVAMLHLAKLGAKLTVLTKDQADYINVPVEGPFKADHYRY