Protein Info for A4249_RS12115 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: dihydrolipoyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01350: dihydrolipoyl dehydrogenase
  • amino acids 8 to 463 (456 residues), 525.8 bits, E=4.6e-162
• PF07992: Pyr_redox_2
  • amino acids 8 to 330 (323 residues), 243.5 bits, E=1.4e-75
• PF12831: FAD_oxidored
  • amino acids 9 to 61 (53 residues), 38.1 bits, 5.6e-13
• PF00890: FAD_binding_2
  • amino acids 9 to 45 (37 residues), 24.5 bits, 6.8e-09
• PF01134: GIDA
  • amino acids 9 to 65 (57 residues), 22.1 bits, 3.4e-08
• PF00070: Pyr_redox
  • amino acids 179 to 254 (76 residues), 74.7 bits, E=3.2e-24
• PF02852: Pyr_redox_dim
  • amino acids 349 to 458 (110 residues), 140.2 bits, E=1.3e-44

Best Hits

Swiss-Prot: 64% identical to DLDH3_PSEAE: Dihydrolipoyl dehydrogenase 3 (lpd3) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 84% identity to bsb:Bresu_0552)

MetaCyc: 49% identical to dihydrolipoyl dehydrogenase subunit (Syntrophotalea carbinolica DSM 2380)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of 2-oxoglutarate dehydrogenase (EC 1.8.1.4)" in subsystem TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Sequence Analysis Tools

See A0A168NNZ6 at UniProt or InterPro

Protein Sequence (468 amino acids)

>A4249_RS12115 dihydrolipoyl dehydrogenase (Brevundimonas sp. GW460-12-10-14-LB2)
MAEATAAYDVVIIGGGPGGYNAAIRAGQLGLKVACVEMRSTLGGTCLNVGCMPSKALLHA
SELWNAANTEFAKIGIEVQPKLHLDQMHKAKDDSVTALTKGIEFLFKKNKADWIKGKGKI
VGKGKVEVTAADGSVQTLDAKNIVIATGSEPTPLPGVAFEDGKVIDSTGALSLPAVPRKL
IVVGAGIIGLELGSVWRRLGAEVTVVEFLDRITPGMDTEVATAFQRTLTKQGMSFKLGAK
VTGAKSGKDGVELTVEPSAGGAAETIKGDVVLVAIGRRPYTDGLGLESVGVTPDKRGFID
HDHFKVADGVWVIGDVTHGPMLAHKAEEDAVAVIDTIAGKYGHVDYALVPSVVYTFPEVA
WVGQTEDQLKAAGVQYKKGKFPFTANSRAKINHETDGFVKVLADAATDKVLGVHIMGPQA
GEMIHEAAITMSFGGASEDIARTCHAHPTRSEAVRQAAMDVEGWMMQA