Protein Info for A4249_RS11960 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 39 to 62 (24 residues), see Phobius details amino acids 74 to 97 (24 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details amino acids 250 to 275 (26 residues), see Phobius details amino acids 286 to 304 (19 residues), see Phobius details amino acids 316 to 338 (23 residues), see Phobius details amino acids 399 to 423 (25 residues), see Phobius details PF05977: MFS_3" amino acids 27 to 416 (390 residues), 117.5 bits, see alignment E=5.9e-38 PF07690: MFS_1" amino acids 39 to 384 (346 residues), 99.1 bits, see alignment E=2.6e-32

Best Hits

KEGG orthology group: None (inferred from 79% identity to bsb:Bresu_0627)

Predicted SEED Role

"MFS permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I2A4 at UniProt or InterPro

Protein Sequence (434 amino acids)

>A4249_RS11960 MFS transporter (Brevundimonas sp. GW460-12-10-14-LB2)
MTTESIAAGPAAPSVPPSPSSGGPEGPSSPWGIRDFRLLWFGRVVAVLAIQIQSSALLWQ
VYEIARRDHPIEEASLYLGLVGLCQFLPLLAFTLPAGAMADRRDRKRTVWISILVEAACA
GSFLAMALHGNPPLWGLLVVAALFGAARAFLAPASQAFLPMVVGRKALPPAIAAQSIAFQ
TGAIAGPALGGVIVGVNVPLAYAVSLGMFLLAVAAFILIRTSGRPAPQANPLSPVDSVKE
GLAYVWKTKIVLGAISLDLVVVLLAGVALLTPIFARDILHVGPQGFGLLRASFGVGAMVM
AIYLSRYPIRQNGGRWMFAAVAVFGLCTITFGLSRIVWLSGPALFIGGAADMISVNVRQT
LIQLATPDHMRGRVSSVSMLFIGASNELGEAYSGVMVRLLGAVGAAVFGGFGALAATGAW
ATMFPGLRKADKLT