Protein Info for A4249_RS11605 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: isoprenylcysteine carboxylmethyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 59 (24 residues), see Phobius details amino acids 69 to 85 (17 residues), see Phobius details amino acids 96 to 120 (25 residues), see Phobius details PF04191: PEMT" amino acids 40 to 139 (100 residues), 47.7 bits, see alignment E=2e-16 PF04140: ICMT" amino acids 53 to 134 (82 residues), 25 bits, see alignment E=2.1e-09

Best Hits

KEGG orthology group: None (inferred from 49% identity to rpe:RPE_0932)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HYV1 at UniProt or InterPro

Protein Sequence (161 amino acids)

>A4249_RS11605 isoprenylcysteine carboxylmethyltransferase family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MSPQAPNRWPWPPLITGGAVLVALITARLWSPPALFPGAFAAGGLLVGLALGLDLWAMLV
MRRWRANILPHRAATALVTTGPFAWSRNPIYLANGLLLLGLGGLFDNAWFFVAAPVAAFA
TDRLAIRREERHLTALFGPAWSAYADRVDRWFGRRMPSQSP