Protein Info for A4249_RS11600 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: cytochrome d ubiquinol oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 6 to 37 (32 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 113 to 137 (25 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 196 to 215 (20 residues), see Phobius details amino acids 227 to 248 (22 residues), see Phobius details amino acids 258 to 280 (23 residues), see Phobius details amino acids 299 to 323 (25 residues), see Phobius details PF02322: Cyt_bd_oxida_II" amino acids 5 to 323 (319 residues), 342.8 bits, see alignment E=1e-106 TIGR00203: cytochrome d ubiquinol oxidase, subunit II" amino acids 5 to 206 (202 residues), 146.6 bits, see alignment E=5.8e-47

Best Hits

KEGG orthology group: K00426, cytochrome bd-I oxidase subunit II [EC: 1.10.3.-] (inferred from 68% identity to ara:Arad_7909)

Predicted SEED Role

"putative Cytochrome bd2, subunit II" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I0U9 at UniProt or InterPro

Protein Sequence (333 amino acids)

>A4249_RS11600 cytochrome d ubiquinol oxidase subunit II (Brevundimonas sp. GW460-12-10-14-LB2)
MSVDLTLVWAGLLAFAVFAYIVMDGFDLGVGILFPTLKAGDQRDKAMNSIAPVWDGNETW
LILGGGGLFAAFPLAYAVLMPAVYTPIIAMLLGLVFRGVAFEYRWRTVRAKPIWDVAFFG
GSLLAAFSQGVTLGAILQGVEVSGRAYGGGSWDWLSPFSLLTGAAVVVGYALLGATWLNM
KTEGALQTHARSQAWKLGPATLLMIGAVSLATPFLDGEYARRWFDWPGVLLTAQVPLLVL
IVAAAFFWTMRQKREVWPFLLSLGLFAVTFAGLGVSVFPYAVPDEITLWQAAAPASSQLF
MLVGALILIPIILAYTAYAYWVFRGKVGDDGYH