Protein Info for A4249_RS11595 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: cytochrome ubiquinol oxidase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 transmembrane" amino acids 13 to 36 (24 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 96 to 119 (24 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 219 to 237 (19 residues), see Phobius details amino acids 321 to 344 (24 residues), see Phobius details amino acids 356 to 378 (23 residues), see Phobius details amino acids 402 to 429 (28 residues), see Phobius details PF01654: Cyt_bd_oxida_I" amino acids 8 to 436 (429 residues), 555.5 bits, see alignment E=3.1e-171

Best Hits

KEGG orthology group: K00425, cytochrome bd-I oxidase subunit I [EC: 1.10.3.-] (inferred from 76% identity to mea:Mex_2p1123)

MetaCyc: 58% identical to cyanide insensitive ubiquinol oxidase subunit I (Pseudomonas putida KT2440)
RXN-6883 [EC: 1.10.3.11]

Predicted SEED Role

"putative Cytochrome bd2, subunit I" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 1.10.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I0S5 at UniProt or InterPro

Protein Sequence (475 amino acids)

>A4249_RS11595 cytochrome ubiquinol oxidase subunit I (Brevundimonas sp. GW460-12-10-14-LB2)
MELDALILARMQFAFTVAFHIVFPAFSIGLASYLAVLEALWLKTGRDLYLNLFKYWLKIF
AVAFGMGVVSGLVMSYQFGTNWSVFSDKAGPVIGPLMAYEVLSAFFLEAGFLGVMLFGLN
RVGKKLHFLATLMVAIGTFASAFWILSVNSWMQTPQGYAINEVGQFVPADWFKIVFNPSF
PYRLAHMLLAAYLTTGLVVGAVGAWHLMKERTNKGARKMFAMAMGMILVAAPVQIFIGDM
HGLNTLEHQPAKVMAMEGHFESHPDGAPLILFGIPDREAATVHGAVEIPKLSSLILKHDP
NAPLAGLDTIDRADWPPVEIVFWSFRVMVGLGMAMLMLGLWGLYARLRKRLYDAPWLHRF
ALIMGPMGFVAVLAGWITTEVGRQPWTVYGLLRTADSAAPLAAPAVATSLAAFAVVYFTV
FGAGVFYILRLMSHAPHRDEPGVAETPIRTAGITPAPAIDPDRPIPTGEETDHER