Protein Info for A4249_RS11570 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: YeeE/YedE thiosulfate transporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 82 to 99 (18 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details PF04143: Sulf_transp" amino acids 10 to 127 (118 residues), 40.5 bits, see alignment E=1.3e-14

Best Hits

Swiss-Prot: 46% identical to Y1892_XYLFT: UPF0394 membrane protein PD_1892 (PD_1892) from Xylella fastidiosa (strain Temecula1 / ATCC 700964)

KEGG orthology group: K07112, (no description) (inferred from 53% identity to pbr:PB2503_11629)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I1F4 at UniProt or InterPro

Protein Sequence (144 amino acids)

>A4249_RS11570 YeeE/YedE thiosulfate transporter family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MLEPLPFIWPLAGGLLVGLSAGLYLLLNGRVAGISGLTAAATGLSKGAPRILGLLFIAGL
LGGAALASALIRRPEVQITSEVWLLVLGGLIVGFGTRWGSGCTSGHGVCGLARLSPRSIV
ATGVFMAVAALTVFITRHLLGGLA