Protein Info for A4249_RS11560 in Brevundimonas sp. GW460-12-10-14-LB2
Annotation: peroxiredoxin
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 45% identical to TDXH2_THEAC: Peroxiredoxin 2 (Ta0954) from Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
KEGG orthology group: K03386, peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC: 1.11.1.15] (inferred from 59% identity to bsb:Bresu_0734)Predicted SEED Role
"Alkyl hydroperoxide reductase subunit C-like protein" in subsystem Oxidative stress or Rubrerythrin or Thioredoxin-disulfide reductase
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.11.1.15
Use Curated BLAST to search for 1.11.1.15
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A160HYN1 at UniProt or InterPro
Protein Sequence (219 amino acids)
>A4249_RS11560 peroxiredoxin (Brevundimonas sp. GW460-12-10-14-LB2) METTDTAPTVDTAAMRALRINDTAPDFTARTTQGEKRLSDYRGRWLVLFSHPADFTPVCT SEFVALARQADAFAAIDCDLMALSVDSLYSHLAWLKDIYRRFGVKVPFPIIEDPSMAIGH AFGMVDAGSSDSATVRATFVIDPEGVVRAISWYPMNIGRSVDELLRLVTALQTSDREAAS TPAGWTPGDALLEPAATTLDAAIADGDGDAPWYYRERRA