Protein Info for A4249_RS11465 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: Cys-tRNA(Pro) deacylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR00011: Cys-tRNA(Pro) deacylase" amino acids 5 to 155 (151 residues), 172.2 bits, see alignment E=3.1e-55 PF04073: tRNA_edit" amino acids 35 to 146 (112 residues), 85.2 bits, see alignment E=1.9e-28

Best Hits

Swiss-Prot: 40% identical to YBAK_SALTY: Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK (ybaK) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 69% identity to smd:Smed_3507)

Predicted SEED Role

"Cys-tRNA(Pro) deacylase YbaK"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161J879 at UniProt or InterPro

Protein Sequence (157 amino acids)

>A4249_RS11465 Cys-tRNA(Pro) deacylase (Brevundimonas sp. GW460-12-10-14-LB2)
MSKTTPATVALTKAGVAFALFPYDYDPDAPRVGLQAAEALGVAPEQVFKTLMVLVDGAPA
CVIVPSDCEVSMKKLAAVLGAKSAQMMRPADAERLTGYKVGGVSPFGQRKAVPTAMDETA
ILFDQVLINGGQRGLLLGLAPEDARRAAKAVLADLTA