Protein Info for A4249_RS11430 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: cell division protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 26 to 48 (23 residues), see Phobius details amino acids 168 to 192 (25 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details amino acids 227 to 249 (23 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details

Best Hits

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 71% identity to bsb:Bresu_3302)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I2Q5 at UniProt or InterPro

Protein Sequence (304 amino acids)

>A4249_RS11430 cell division protein (Brevundimonas sp. GW460-12-10-14-LB2)
MIRLSDFSLSSRRPGLLPPAAAGEPWLMTVIAVLCFLACLAAVAASAADRAAHGWARQLG
AEATVQVRPRVGETGDTAAARAAETLSGVDGVEEAAALSRKAAEDLLRPWLGDAVLPDLP
LPHLVTVRLNRDAPASAVTLSRALAEAGLDATVDDHSLWRGEVERSAGMITVLAGAAFLA
VAFAAAAAIAYATRAGLAAGQGVIETLSLNGATDGTIAWLFQRRFGLMAAGAGAIGAGLA
AVLLILLRFIGGSGGLTAALPISWSDLALLSPCPLLAATVAVLAARFAAMRMLASGRPTE
GGGA