Protein Info for A4249_RS11425 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ATP-binding cassette domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 31 to 178 (148 residues), 111 bits, E=7.3e-36

Best Hits

Swiss-Prot: 42% identical to FTSE_ECO57: Cell division ATP-binding protein FtsE (ftsE) from Escherichia coli O157:H7

KEGG orthology group: K09812, cell division transport system ATP-binding protein (inferred from 72% identity to bsb:Bresu_3301)

MetaCyc: 36% identical to L-glutamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division (TC 3.A.5.1.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

See A0A160I048 at UniProt or InterPro

Protein Sequence (236 amino acids)

>A4249_RS11425 ATP-binding cassette domain-containing protein (Brevundimonas sp. GW460-12-10-14-LB2)
MPSSSAEPAAMTETVRLSGVGFGYVGAPDVLRDVNLILPRGSFHFLTGPSGAGKSSLLRL
LTLADQPRTGTLRLFGSDVTRIDRRDIPAFRRRMGVVFQDFRLLDHLSAFDNVALPLRLA
GGSEAEYADDVREMLKWVGLGRRMEARPPALSGGEKQRLAIARAVITRPGLIVADEPTGS
VDAVMADKLLRLFQSLNKLGATVLIASHDEALAQRSGARVLRLEAGRLSESSRATA