Protein Info for A4249_RS11365 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: cation diffusion facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 23 to 42 (20 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 123 to 142 (20 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 190 to 208 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 19 to 297 (279 residues), 199.9 bits, see alignment E=2.7e-63 PF01545: Cation_efflux" amino acids 24 to 216 (193 residues), 121.9 bits, see alignment E=3.1e-39 PF16916: ZT_dimer" amino acids 221 to 296 (76 residues), 69.2 bits, see alignment E=2.6e-23

Best Hits

Swiss-Prot: 37% identical to FIEF_SALAR: Cation-efflux pump FieF (fieF) from Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)

KEGG orthology group: None (inferred from 66% identity to bsb:Bresu_3142)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I1C4 at UniProt or InterPro

Protein Sequence (328 amino acids)

>A4249_RS11365 cation diffusion facilitator family transporter (Brevundimonas sp. GW460-12-10-14-LB2)
MTTPAPAPASLDDAHLATRRITRLSVGVAVVLIAMKAFALGASGSVSILATLADSVLDLA
ASLTTFFAVRWAAAPADEDHRYGHGKGEALSALVQAGLVFASAIFIAWEGVQRIFDPRPV
TSGVWATGVMVAAIAITAWLVWMQTQTLKKTGSLAVAGDRAHYAADLAANVVVLIGVISG
AFLGAPGLDAAAGIVVAVWLFWGATGMLKAAADHLLDRAVPEADRAAITKAVLADPQVFG
VHQLRTRMSGQVMMVQMHVDLDAHQTLDAAHAIVVAAENRVLAQYPAADILIHADPRGHA
GPQPAIPAAAPAEPQAASTGPAPKGPWS