Protein Info for A4249_RS11355 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 PF05175: MTS" amino acids 133 to 295 (163 residues), 164.2 bits, see alignment E=5.7e-52 PF06325: PrmA" amino acids 163 to 231 (69 residues), 24 bits, see alignment E=6.4e-09 PF08241: Methyltransf_11" amino acids 165 to 263 (99 residues), 22 bits, see alignment E=5.3e-08 PF13649: Methyltransf_25" amino acids 165 to 260 (96 residues), 34.2 bits, see alignment E=8.2e-12 PF01170: UPF0020" amino acids 187 to 269 (83 residues), 24.5 bits, see alignment E=5.1e-09

Best Hits

KEGG orthology group: K00564, ribosomal RNA small subunit methyltransferase C [EC: 2.1.1.172] (inferred from 73% identity to bsb:Bresu_3226)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase C (EC 2.1.1.52)" (EC 2.1.1.52)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.172 or 2.1.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NN53 at UniProt or InterPro

Protein Sequence (299 amino acids)

>A4249_RS11355 class I SAM-dependent methyltransferase (Brevundimonas sp. GW460-12-10-14-LB2)
MTTLLYGRPPVVFDPPGDATQTSPLIPDSAALEAQEPSSADSVMIYAPPGVLERRYVLAL
ALKALKVGGRLDVMAPKDKGGSRLAKELKAFGVEVAETAKAHHRRCIVIRPETVEGLDEA
IAAGEPQIVPGLEAWSQPGVFAWDRIDPGSALLAEHLPAMKGEGVDLGCGYGALSIVVLR
SPAVSKLKMVDLDRRAIQAARRNIEDDRAKVWWSDARTLEAKGDKDFVVSNPPFHDGGAE
DRRLGQAFIRKAAELLKKGGVAWVVANRHLPYEAELNTAFKRVRLVAEAGGYKLFEAVK