Protein Info for A4249_RS11320 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: tryptophan synthase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 PF00290: Trp_syntA" amino acids 10 to 266 (257 residues), 302.2 bits, see alignment E=1.1e-94 TIGR00262: tryptophan synthase, alpha subunit" amino acids 10 to 257 (248 residues), 241.9 bits, see alignment E=2.6e-76

Best Hits

Swiss-Prot: 72% identical to TRPA_PHEZH: Tryptophan synthase alpha chain (trpA) from Phenylobacterium zucineum (strain HLK1)

KEGG orthology group: K01695, tryptophan synthase alpha chain [EC: 4.2.1.20] (inferred from 77% identity to bsb:Bresu_3221)

Predicted SEED Role

"Tryptophan synthase alpha chain (EC 4.2.1.20)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 4.2.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.20

Use Curated BLAST to search for 4.2.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NYG0 at UniProt or InterPro

Protein Sequence (280 amino acids)

>A4249_RS11320 tryptophan synthase subunit alpha (Brevundimonas sp. GW460-12-10-14-LB2)
MTTARIDARFKALKAEGRAAFIPYVMGGDPSREEALAILNGLPAAGADIIELGFPFSDPM
AEGPPIQRAAIRGMAAGFGLRSTMDLAKEFRKGDDATPIVLMGYLNPIESLGYDAFAAYA
ADCGIDGLIVVDCPPEEAGPLIEALDKVSISLIRLATPTSDDERLKIVVQGTSGFVYYVA
VAGVTGVKEANADVVAPAVERVRKASGLPVAVGFGVKTPERAAEIARVADAVVVGSALVD
EVAAALEANEPVAARVLARVKALGDAVRSVAASASVAETV