Protein Info for A4249_RS11295 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: thioredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00085: Thioredoxin
  • amino acids 3 to 103 (101 residues), 115 bits, E=2.9e-37
• TIGR01068: thioredoxin
  • amino acids 7 to 104 (98 residues), 121 bits, E=1.1e-39
• PF13098: Thioredoxin_2
  • amino acids 17 to 102 (86 residues), 35.3 bits, E=2.5e-12
• PF13728: TraF
  • amino acids 25 to 92 (68 residues), 23.7 bits, E=7.9e-09

Best Hits

Swiss-Prot: 65% identical to THIO_RHORU: Thioredoxin (trxA) from Rhodospirillum rubrum

KEGG orthology group: K03671, thioredoxin 1 (inferred from 89% identity to bsb:Bresu_3174)

MetaCyc: 60% identical to reduced thioredoxin 1 (Escherichia coli K-12 substr. MG1655)
RXN-20161 [EC: 1.8.4.16]

Predicted SEED Role

"FIG149041: Thioredoxin"

MetaCyc Pathways

• periplasmic disulfide bond reduction (1/2 steps found)
• cytochrome c biogenesis (system I type) (3/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.16

Sequence Analysis Tools

See A0A168NN41 at UniProt or InterPro

Protein Sequence (109 amino acids)

>A4249_RS11295 thioredoxin (Brevundimonas sp. GW460-12-10-14-LB2)
MATVKVTDESFDADVLKSSTPVLVDFWAEWCGPCKQIGPALEQIADELGGQVTVAKINID
DSPMTPSKLGVKGIPTLMLFKDGQMASMKVGAMPKGKIVEWLAEAGVKA