Protein Info for A4249_RS11160 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: SDR family NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 PF00106: adh_short" amino acids 8 to 205 (198 residues), 159.3 bits, see alignment E=1.3e-50 PF08659: KR" amino acids 10 to 183 (174 residues), 81.5 bits, see alignment E=1.1e-26 PF13561: adh_short_C2" amino acids 14 to 204 (191 residues), 118.3 bits, see alignment E=6.3e-38

Best Hits

KEGG orthology group: None (inferred from 85% identity to bsb:Bresu_0762)

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I0P3 at UniProt or InterPro

Protein Sequence (302 amino acids)

>A4249_RS11160 SDR family NAD(P)-dependent oxidoreductase (Brevundimonas sp. GW460-12-10-14-LB2)
MVMRFDGQVAIVTGAGGGLGREHALALAARGAKVVVNDLGGARDGSGGSASAADAVVAEI
EAAGGEAIANAASVTDYAAVQAMVDQAMTKWGRIDILVNNAGVLRDKTFAKMDIEDFRFV
VDVHLMGAVNCTKAVWEIMRGQNYGRIVMTTSSSGLYGNFGQSNYGAAKMALVGLMQTLS
IEGAKNDVRVNCLAPTAHTRMTEDLGAALPLEALAPALVTPGLLYLVSQDAPSRAILAAG
AGGFERAYVTLTQGDFVTGDDAPEQVAARFDAISDRSGEIVPDMGAAQGMIELTKAQKAH
GG