Protein Info for A4249_RS11120 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: translation initiation factor IF-3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05198: IF3_N
  • amino acids 12 to 81 (70 residues), 97.8 bits, E=3.3e-32
• TIGR00168: translation initiation factor IF-3
  • amino acids 12 to 173 (162 residues), 210.1 bits, E=7.8e-67
• PF00707: IF3_C
  • amino acids 88 to 172 (85 residues), 133.1 bits, E=2.8e-43

Best Hits

Swiss-Prot: 84% identical to IF3_PHEZH: Translation initiation factor IF-3 (infC) from Phenylobacterium zucineum (strain HLK1)

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 92% identity to bsb:Bresu_0344)

Predicted SEED Role

"Translation initiation factor 3"

Sequence Analysis Tools

See A0A168NMY5 at UniProt or InterPro

Protein Sequence (173 amino acids)

>A4249_RS11120 translation initiation factor IF-3 (Brevundimonas sp. GW460-12-10-14-LB2)
MQAPPVKDGPRMNQDIRAPRVLLIDQNGEKQGVMPTSAALEAAEEAGMDLVEIVSTSEPP
VAKILDYGKHRFQEQKKKAEQRKRQKVVELKEIKLRPNIDTHDYEVKAKAMHRFFEEGDK
VKVTLRFRGREMAHPELGMKLLNKVQADFDEVAKVEFSPKMEGRQMIMILAPR