Protein Info for A4249_RS11115 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 227 to 250 (24 residues), see Phobius details amino acids 262 to 281 (20 residues), see Phobius details amino acids 293 to 315 (23 residues), see Phobius details amino acids 331 to 351 (21 residues), see Phobius details amino acids 371 to 394 (24 residues), see Phobius details amino acids 400 to 419 (20 residues), see Phobius details PF06779: MFS_4" amino acids 12 to 191 (180 residues), 41 bits, see alignment E=5e-14 PF07690: MFS_1" amino acids 24 to 339 (316 residues), 160.1 bits, see alignment E=2.1e-50 amino acids 279 to 416 (138 residues), 55 bits, see alignment E=2e-18 PF13347: MFS_2" amino acids 29 to 358 (330 residues), 40.9 bits, see alignment E=3e-14 PF12832: MFS_1_like" amino acids 36 to 402 (367 residues), 27.8 bits, see alignment E=4e-10 PF00083: Sugar_tr" amino acids 52 to 200 (149 residues), 55.6 bits, see alignment E=1.4e-18

Best Hits

Predicted SEED Role

"Major facilitator superfamily MFS_1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HYG4 at UniProt or InterPro

Protein Sequence (434 amino acids)

>A4249_RS11115 MFS transporter (Brevundimonas sp. GW460-12-10-14-LB2)
MTNADTVAARTPPPKLKTPALAVLFATVFINLVGFGLVVPLLPFFAQSLKAEAWQITLMF
SAYSLGQFFAEPFWGRLSDRIGRKPVLLMTLIANALGYLMLAFVPNIWLAIAVRLFTGLG
AGNISTVQGYVADVTPPEQRAGRMGLIGAAFGLGFIVGPGLGGLLTQPQLGRLGYQLPIF
LAAALAAVAAVGVVVFLRESRAKADPAAPRPAFLAGLKDARDNAVVSRVLVVTLIYMAGF
SAMESVFGLWSESRYQWGAREVGLSFMIVGIVSTLNQGFFAGRLARRFGESRVLATGMLL
FGTSLVLQVLAPVAWFPATRLELGALTIPVVQGWIIPIVMAIGACGMSLAMPNISAMISR
ASPPDRQGAMLGLNMASSSVARIFGPMIAGALFSGLGHDWPFVIGALLTIPAALMAINAG
RVIRSGEGGVKAPA