Protein Info for A4249_RS11100 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 PF00571: CBS" amino acids 14 to 51 (38 residues), 18.3 bits, see alignment 5e-07 PF00512: HisKA" amino acids 160 to 225 (66 residues), 62.8 bits, see alignment E=4.9e-21 PF02518: HATPase_c" amino acids 272 to 380 (109 residues), 93.8 bits, see alignment E=1.9e-30 PF00072: Response_reg" amino acids 403 to 516 (114 residues), 87.9 bits, see alignment E=1.1e-28

Best Hits

Predicted SEED Role

"FIG00449673: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I0N4 at UniProt or InterPro

Protein Sequence (531 amino acids)

>A4249_RS11100 response regulator (Brevundimonas sp. GW460-12-10-14-LB2)
MPLIGDFVDLIAPVAPSTPGADVFERFQTEPNTLALAIVDDDGRPLGIIERNAFTLRMAA
EFGRALYARKPAESLMDRNAPVAEAATSAEAFFHAYGAAELGALLTGFIVVADGRYVGVG
TALQVVQAGAALHRQRAEEMSALARDLALAEAEAVASSRAKSEFLAVMSHEIRTPLNGVL
GVAALMDKKLEQEELRPYVRTVIDSGQSLLRLLTDALDMSRASAGMMTLEEEPLDLSAVA
FDIDALWRARAEEKALALTVRIDLAVPCVRADGMRLKQLLNNLIGNALKFTLTGEVVALI
ESHSDGEVIFTVDDSGPGVPEAAAATIFDPFNTGKAGREGAGAGLGLAICRQIAERMGGA
ISLGASPQGGARFQVRLPLRVASESAAPAPAMAEPTPHDTLHVLVVDDNATNRFVAGKLL
EMFGCTCEMAENGHEAVDAVMARPFDLALMDIKMPVMDGVAATRAIRALPGPAHALPILA
LTANADERDELDYIAAGMNGVAQKPIQPDALLNAIRMVLAQSQASHVPKAA