Protein Info for A4249_RS10990 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ATP-dependent protease ATPase subunit HslU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 TIGR00390: ATP-dependent protease HslVU, ATPase subunit" amino acids 4 to 433 (430 residues), 598.6 bits, see alignment E=3.9e-184 PF07728: AAA_5" amino acids 52 to 89 (38 residues), 24.9 bits, see alignment 4.4e-09 PF00004: AAA" amino acids 53 to 105 (53 residues), 27.9 bits, see alignment 7.5e-10 amino acids 193 to 322 (130 residues), 41.3 bits, see alignment E=5.2e-14 PF07724: AAA_2" amino acids 185 to 319 (135 residues), 91.1 bits, see alignment E=2.1e-29 PF10431: ClpB_D2-small" amino acids 325 to 396 (72 residues), 25.9 bits, see alignment E=2.1e-09

Best Hits

Swiss-Prot: 76% identical to HSLU_PHEZH: ATP-dependent protease ATPase subunit HslU (hslU) from Phenylobacterium zucineum (strain HLK1)

KEGG orthology group: K03667, ATP-dependent HslUV protease ATP-binding subunit HslU (inferred from 87% identity to bsb:Bresu_0020)

Predicted SEED Role

"ATP-dependent hsl protease ATP-binding subunit HslU" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NYB4 at UniProt or InterPro

Protein Sequence (433 amino acids)

>A4249_RS10990 ATP-dependent protease ATPase subunit HslU (Brevundimonas sp. GW460-12-10-14-LB2)
MTELTPREIVSELDRYIVGQNDAKRAVAVALRNRWRRKRVPADLRDEVTPKNILMIGPTG
VGKTEIARRLARLAGSPFLKVEATKFTEVGYVGRDVDQIVRDLVESALIMVRERRRGDVR
AKAEAAAEDRILDALVGPGAGPATRDSFRKKLRAGGLDDKEIEISLADTASPIQGLDIPG
GGNVGLLNLSEMLGKIGGGRTKTVKLAVRDATTPLIAEEGDKLLDQDSLTQEALKLAENE
GIVFLDEIDKVAARQGASSADVSREGVQRDLLPLIEGTTVSTKYGPVKTDHVLFIASGAF
HVAKPSDLLPELQGRLPIRVELKALTRDDFKRILTEPEANLIRQNQALLATEDVTLTFTD
DAVEAMADAAVAANSAVENIGARRLQTVMERVLEETSFKASDLSGQTVTFDGDAVREKMD
ALTKDVDLSRFIL