Protein Info for A4249_RS10900 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: 30S ribosomal protein S1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 TIGR00717: ribosomal protein bS1" amino acids 11 to 529 (519 residues), 632.5 bits, see alignment E=2.6e-194 PF00575: S1" amino acids 25 to 93 (69 residues), 25.7 bits, see alignment E=1.9e-09 amino acids 110 to 178 (69 residues), 43.2 bits, see alignment E=6.2e-15 amino acids 197 to 267 (71 residues), 78.3 bits, see alignment E=6.8e-26 amino acids 281 to 354 (74 residues), 71.9 bits, see alignment E=6.8e-24 amino acids 370 to 441 (72 residues), 66.8 bits, see alignment E=2.8e-22 amino acids 456 to 529 (74 residues), 50.6 bits, see alignment E=3e-17

Best Hits

Swiss-Prot: 67% identical to RS1_RHIME: 30S ribosomal protein S1 (rpsA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02945, small subunit ribosomal protein S1 (inferred from 92% identity to bsb:Bresu_0787)

Predicted SEED Role

"SSU ribosomal protein S1p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161IWV4 at UniProt or InterPro

Protein Sequence (567 amino acids)

>A4249_RS10900 30S ribosomal protein S1 (Brevundimonas sp. GW460-12-10-14-LB2)
MSDTLNPTRDDFSALLDEQLSGRDFGEGQVVHGRVVGIEKDIVIIDVGLKTEGRIAMREF
GQGDDGALPKVGDNVEVYLERVENALGEAVISRDKARREEAWTRLEVVFAEGQPVNGAIV
GRVKGGFTVDLGGASAFLPGSQVDIRPVRDVGPLMGKEQPFAILKMDRPRGNIVVSRRAI
LEEARAEQRTELVGQLAEGEVREGVVKNITDYGAFVDLGGIDGLLHVTDMSWKRVSHPSQ
VLAVGDTVKVQIVKINPDTQRISLGMKQLQSDPWDGVEAKYPVGAKYTGRITNITDYGAF
VELEAGVEGLVHVSEMSWTKKNVHPGKIVSTSQEVDVVVLDVDASKRRISLGLKQAQDNP
WDAFVANNPIGSTVEGEVKNATEFGLFIGLDNDIDGMVHLSDLDWSVSGEEAIQRYRKGE
MVKAKVLDVDVEKERVSLGIKQLGGDPIGEGDTYRRGQQITVTVTAIESGGIEVKFGEDD
APVTAFVRKSDLSRDRNEQRPERFAVGDRVDAMITAVDKASRRVSVSIKALEMKDEQEAI
EQFGSSDSGASLGDILGAALKNAGTKE