Protein Info for A4249_RS10875 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: TonB-dependent receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 689 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00593: TonB_dep_Rec" amino acids 229 to 647 (419 residues), 73.3 bits, see alignment E=3.8e-24 PF14905: OMP_b-brl_3" amino acids 315 to 569 (255 residues), 28.6 bits, see alignment E=8e-11

Best Hits

KEGG orthology group: None (inferred from 73% identity to cse:Cseg_3931)

Predicted SEED Role

"Outer membrane receptor proteins, mostly Fe transport" in subsystem Hemin transport system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HYD3 at UniProt or InterPro

Protein Sequence (689 amino acids)

>A4249_RS10875 TonB-dependent receptor (Brevundimonas sp. GW460-12-10-14-LB2)
MTKTLLLASTALLFTASAAFAGDKPQVAEAPVPTGPTNQAPLADASQRGVLVFTPDFFAA
QRPNTALDMVNRVPGFSIDNGSGARGFEGAVGNVLINNNRPASKNDSGSNVLGRTLANQV
ERIELIRGGAPGIDMQGYSVVVNVILKTSDSRQSILTWNAMLFEGGHDIYGGSYQFTQNK
GDRSWGVTLSDGMGSSDSNGVGRSVRRNAAGDVIRDERYENDGWGGGQGIRGNYTGPLFG
GKLEGTARYGLNDYQNWTELSSPTSLRRSDYAEDGDSGELGLTWTRTLNPRWTLETRLIH
EFSSFDSVSGSNETLNGTAAPEQQFKSNGDSSESILRALVRHERSPALTIEAGAEIAYNM
LDVNQAFTIGGVGVPLPSASVKVEETRGEAFSKATWRINPKLTLEGGVRLEASTISQSGD
ADQEKSFFFAKPRLLATWTPMADNQLRFRFERELGQLDFGDFAASAELSDGTVFGGNVDL
EPEQRWISELSYERRFWGEGVVSIGYRHDRIIDVIDRLPLPGGLSATGNIGDGTLDQLSL
NVVVPLDKVGISGARFTFRNDWNKTSVNDPTTGEDRRISGVRPSQANVGFQQDITSWKTQ
WGINWLPRLGQATYDPDQTFAWRGADYLEAFVEYKPSPTLSLRAQLNLWDDFTQQRTVYA
TRNPRTVAFVEERSIDPRTFVSLRVRKTF