Protein Info for A4249_RS10850 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 23 to 45 (23 residues), see Phobius details amino acids 57 to 84 (28 residues), see Phobius details amino acids 104 to 133 (30 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details amino acids 200 to 217 (18 residues), see Phobius details amino acids 223 to 247 (25 residues), see Phobius details PF01061: ABC2_membrane" amino acids 8 to 218 (211 residues), 110.6 bits, see alignment E=8e-36 PF12698: ABC2_membrane_3" amino acids 57 to 244 (188 residues), 34.5 bits, see alignment E=1.3e-12

Best Hits

Swiss-Prot: 40% identical to YADH_ECOLI: Inner membrane transport permease YadH (yadH) from Escherichia coli (strain K12)

KEGG orthology group: K01992, ABC-2 type transport system permease protein (inferred from 89% identity to bsb:Bresu_3149)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NMM9 at UniProt or InterPro

Protein Sequence (255 amino acids)

>A4249_RS10850 ABC transporter permease (Brevundimonas sp. GW460-12-10-14-LB2)
MTFNGYGVWAIYRFEMARALRTLWQSVVTPVITTALYFVVFGGAIGSRMQQVDGVPYGAF
IVPGLIMLSLFTQSIFNASFGIYFPKFTGTIYEILSAPVSSLEIVLAYVGAAATKSAVLG
LIILATAAFFVPLQILHPVWMMAFLILISVTFSLFGFIIGVWANGFEQLQMIPMLVVTPL
TFLGGAFYSIDMLPDGWRTVTLFNPVVYLISGFRWAFYGQGDVAIGVSVTATLGFFAVCL
GIVMWMFKTGYRLKN