Protein Info for A4249_RS10830 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: cytochrome c maturation protein CcmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 64% identical to CCME_PHEZH: Cytochrome c-type biogenesis protein CcmE (ccmE) from Phenylobacterium zucineum (strain HLK1)

KEGG orthology group: K02197, cytochrome c-type biogenesis protein CcmE (inferred from 81% identity to bsb:Bresu_0880)

MetaCyc: 43% identical to periplasmic heme chaperone (Escherichia coli K-12 substr. MG1655)
RXN-21407

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmE, heme chaperone" in subsystem Biogenesis of c-type cytochromes

MetaCyc Pathways

cytochrome c biogenesis (system I type) (3/11 steps found)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161IMG3 at UniProt or InterPro

Protein Sequence (161 amino acids)

>A4249_RS10830 cytochrome c maturation protein CcmE (Brevundimonas sp. GW460-12-10-14-LB2)
MSWLPKSPKARRRLWVVAAVAPILALAVGLSLWAMQDSVTFFYSPSEATADKAPEGRNIR
LGGLVEAGSVQKTGDGVVAFVVTDNAATTRVVYHGDLPDLFREGQGIVAQGAFGADRTFH
ASQVLAKHDENYMPREVADRLKEKGEWRPETAPAATKSVPL